Logo What's After the Movie

House of Mortal Sin 1976

When a troubled young girl seeks confession at the local church, the priest listening to her harbors a dark sexual frustration that quickly turns into obsession. He begins stalking her, resorting to blackmail, threats and even murder in his relentless pursuit to keep her under his control.

When a troubled young girl seeks confession at the local church, the priest listening to her harbors a dark sexual frustration that quickly turns into obsession. He begins stalking her, resorting to blackmail, threats and even murder in his relentless pursuit to keep her under his control.

Does House of Mortal Sin have end credit scenes?

No!

House of Mortal Sin does not have end credit scenes. You can leave when the credits roll.

Meet the Full Cast and Actors of House of Mortal Sin

Explore the complete cast of House of Mortal Sin, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Take the Ultimate House of Mortal Sin Movie Quiz

Challenge your knowledge of House of Mortal Sin with this fun and interactive movie quiz. Test yourself on key plot points, iconic characters, hidden details, and memorable moments to see how well you really know the film.


House of Mortal Sin Quiz: Test your knowledge of the 1976 horror film *House of Mortal Sin* with these ten questions ranging from easy to hard.

Who is the elderly priest that Jenny first meets at the church?

Full Plot Summary and Ending Explained for House of Mortal Sin

See more

Read the complete plot summary of House of Mortal Sin, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


Hearing that her friend Bernard Cutler has become a Catholic priest, Jenny Welch goes to a church to seek him out, only to discover that the man hearing confessions is not Bernard at all but the elderly Father Xavier Meldrum. She leaves quickly, but not before telling Meldrum that her on-off boyfriend, Terry Wyatt, recently pressured her into an abortion. The encounter unsettles her, and the encounter with Meldrum’s outwardly kind demeanor will prove to be the beginning of a chilling, controlling arc.

That night, while Jenny is out, Meldrum gains entry to her flat and assaults her friend Robert, mistaking him for Terry. The unconscious Robert is rushed to hospital, setting in motion a sequence of events that reveal Meldrum’s true nature: a priest who believes in “divine justice” and who uses emotional manipulation and fear to punish those he sees as sinners.

The following day, Meldrum invites Jenny to his presbytery, which he shares with his frail, bed-bound mother, Mrs Meldrum, and his housekeeper, Miss Brabazon. During the visit, Jenny discovers that Meldrum kept a taped confession from her and intends to use it as blackmail. The revelation chills her; she contacts Terry to warn him, and Terry tracks Meldrum down, only to be threatened. Meldrum escalates violently, bludgeoning Terry to death with an incense burner and burying him in a freshly dug grave in the churchyard. Later, Meldrum quietly murders Robert in hospital, cementing his role as a dangerous predator.

At first, Jenny’s claims seem hard to believe, but her sister Vanessa Welch answers a threatening call on Jenny’s behalf and begins to see the truth. Vanessa goes to the presbytery and encounters Meldrum’s mother and Miss Brabazon, who both know the priest’s volatile temper and his capacity for cruelty. Mrs Meldrum, aware that her son is unstable, pleads with Vanessa to help. Meldrum arrives, and in a brutal moment, he strangles Vanessa. At Brabazon’s urging, he then murders his own mother under the guise of mercy, driven by a twisted logic that he believes will sustain his sacred life in the church.

Brabazon consoles Meldrum and claims she has always loved him, even though his mother forced him to abandon any wedding plans and embrace celibacy by entering the church. The pair hatch a suicide pact to be together forever, but Brabazon’s self-inflicted wound changes the course of their plan; she fatally stabs herself, leaving Meldrum to contend with the aftermath. Bernard discovers the bodies of Terry and Vanessa and confronts Meldrum, who insists that Brabazon acted out of love for him and tries to persuade Bernard to help cover up the crimes “for the good of the church.” After Bernard leaves, Meldrum silent-calls Jenny to check that she is at home, then slips on a cloak and steps out into the night, leaving the consequences of his actions to echo through the quiet streets.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Discover Film Music Concerts Near You – Live Orchestras Performing Iconic Movie Soundtracks

Immerse yourself in the magic of cinema with live orchestral performances of your favorite film scores. From sweeping Hollywood blockbusters and animated classics to epic fantasy soundtracks, our curated listings connect you to upcoming film music events worldwide.

Explore concert film screenings paired with full orchestra concerts, read detailed event information, and secure your tickets for unforgettable evenings celebrating legendary composers like John Williams, Hans Zimmer, and more.

Concert Film CTA - Music Note
Concert Film CTA - Green Blue Wave

Cars Featured in House of Mortal Sin

See 29 more

Explore all cars featured in House of Mortal Sin, including their makes, models, scenes they appear in, and their significance to the plot. A must-read for car enthusiasts and movie buffs alike.


Alfa

1972

Romeo 2000 Spider Veloce

Audi

1973

80 B1

Austin

1971

1300 MkIII

Austin

1962

A60 Cambridge

Austin

1961

A40 MkII

Austin

1971

Maxi

Austin

1973

Maxi

Austin

1968

Mini Countryman MkII

Datsun

1973

240K

Fiat

1974

128

House of Mortal Sin Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


serial killeraltar boyafghan coatnews reportcryingcrying womandrawernotepadfatherfather daughter relationshipmother daughter relationshipparent child relationshipsuicidefall from heightcandlestickwhite candlealtarcrucifixconfessionalconfession boothcrucifix necklacecross necklacecar accidentturtleneckjumping from a windowjumping out a windowwoman asks man to leavepewsprayingprayerkneelingmissing someoneevil priestabortionlate for an appointmentpay phonepublic phonepublic telephonedriving in the rainphone boxred telephone boxrecord albumvinyl recordheadphonesrecord playerblack glovesintruderbookshelfvending machinebuying a cigarette

House of Mortal Sin Other Names and Titles

Explore the various alternative titles, translations, and other names used for House of Mortal Sin across different regions and languages. Understand how the film is marketed and recognized worldwide.


The Confessional La casa del peccato mortale Mortelles confessions La casa del pecado mortal The Confessional Murders Дом смертного греха The Confessional: House of Mortal Sin To spiti me ta thanasima amartimata Το Σπίτι με τα Θανάσιμα Αμαρτήματα Haus der Todsünden 罪之屋

Similar Movies To House of Mortal Sin You Should Know About

Browse a curated list of movies similar in genre, tone, characters, or story structure. Discover new titles like the one you're watching, perfect for fans of related plots, vibes, or cinematic styles.


© 2026 What's After the Movie. All rights reserved.