Logo What's After the Movie

Blink Twice 2024

A whirlwind romance blossoms between billionaire Slater King and cocktail waitress Frida, quickly escalating into a trip to his private island. As the group indulges in luxurious nights and days, a sinister plot begins to unfold, threatening the idyllic paradise and forcing them to confront a growing darkness.

A whirlwind romance blossoms between billionaire Slater King and cocktail waitress Frida, quickly escalating into a trip to his private island. As the group indulges in luxurious nights and days, a sinister plot begins to unfold, threatening the idyllic paradise and forcing them to confront a growing darkness.

Does Blink Twice have end credit scenes?

No!

Blink Twice does not have end credit scenes. You can leave when the credits roll.

Meet the Full Cast and Actors of Blink Twice

Explore the complete cast of Blink Twice, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Ratings and Reviews for Blink Twice

See how Blink Twice is rated across major platforms like IMDb, Metacritic, and TMDb. Compare audience scores and critic reviews to understand where Blink Twice stands among top-rated movies in its genre.


Echo Score

The Movie Echo Score

67

Blink Twice delivers a visually arresting psychological thriller that balances stylish direction with uneven narrative consistency. Numerous critics commend its confident debut direction, striking cinematography, and moments of genuine suspense, while others note predictable plot turns and surface-level thematic exploration. Audience reactions mirror this split, with praise for the performances and tone but criticism for plot holes and blunt messaging. Ultimately, the film stands as a moderately engaging thriller whose aesthetic strengths are tempered by erratic storytelling clarity.

The Movie Echo Score Breakdown for Blink Twice

80
Echo Score

Art & Craft

In terms of art and craft, Blink Twice establishes a distinctive visual identity through confident direction and polished cinematography. Critics note the production design’s cohesive flair and measured editing that underscore the film’s tone. Some view the stylistic choices as occasionally self-conscious, yet the overall execution demonstrates a clear aesthetic vision that strengthens its thematic intent.

70
Echo Score

Character & Emotion

When it comes to character and emotion, performances in Blink Twice earn frequent acclaim for their intensity. Zoe Kravitz’s restrained portrayal and Channing Tatum’s dramatic turn receive positive mention, though some observers find emotional arcs underdeveloped and interpersonal dynamics lacking subtlety. The result is effective surface-level engagement but limited depth in sustaining lasting character investment.

55
Echo Score

Story & Flow

In terms of story and flow, Blink Twice engages initially with suspenseful pacing and provocative thematic material. Critics and viewers alike praise the film’s gripping premise but frequently cite predictability, tonal inconsistency, and occasional plot holes that disrupt narrative cohesion. These uneven elements create a fragmented progression that tempers overall engagement with the unfolding drama.

75
Echo Score

Sensory Experience

When considering the sensory experience, Blink Twice delivers a compelling audiovisual presentation marked by a tailored score and crisp sound design. Viewers note an understated yet effective soundtrack that complements the film’s polished visual style and editing rhythms. While some tonal shifts can feel jarring, the overall sensory cohesion contributes strong atmospheric immersion.

55
Echo Score

Rewatch Factor

In terms of rewatch factor, Blink Twice offers memorable set pieces and thematic intrigue on first viewing but reveals cracks upon reflection. Several critics and audiences describe diminishing returns as plot inconsistencies and overt messaging become more apparent. Although the film’s atmosphere retains some appeal, the uneven narrative undermines its long-term replay value.

Metacritic

66

Metascore

6.4

User Score

Rotten Tomatoes
review

75%

TOMATOMETER

review

71%

User Score

IMDb

6.5 /10

IMDb Rating

Movie Insider

4.50/5

From 2 fan ratings

Take the Ultimate Blink Twice Movie Quiz

Challenge your knowledge of Blink Twice with this fun and interactive movie quiz. Test yourself on key plot points, iconic characters, hidden details, and memorable moments to see how well you really know the film.


Blink Twice Quiz: Test your knowledge on the intriguing plot twists and characters of 'Blink Twice'.

What profession do Frida and Jess hold at Slater King's gala?

Awards & Nominations for Blink Twice

Explore awards

Discover all the awards and nominations received by Blink Twice, from Oscars to film festival honors. Learn how Blink Twice and its cast and crew have been recognized by critics and the industry alike.


52nd Saturn Awards 2025

Nomination

Best Thriller Film

Full Plot Summary and Ending Explained for Blink Twice

See more

Read the complete plot summary of Blink Twice, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


The cinematic journey unfolds with Frida (Naomi Ackie), a woman engrossed in her mobile device, who unexpectedly encounters the controversial billionaire Slater King (Channing Tatum). Despite a tumultuous year marked by scandal, Slater is desperate to rehabilitate his tarnished public image and seek redemption. As Frida and her loyal friend Jess (Alia Shawkat) work as cocktail servers at Slater’s extravagant gala, they become entwined in the chaos of elite social indulgence.

As the festivities progress, Jess ingeniously smuggles in a collection of glamorous dresses, allowing both women to blend in as surprise guests among the sea of tuxedos. However, an unfortunate mishap occurs when one of Frida’s heels breaks, leading her to topple directly into the arms of a waiter. Slater quickly comes to her rescue, charmingly reintroducing her to his circle of affluent friends as the night escalates.

The evening takes an enticing turn when Slater invites Frida and Jess to his exclusive private island where they will mingle with an array of colorful personalities, including Rich (Kyle MacLachlan), the therapist; Vic (Christian Slater), a photographer; Cody (Simon Rex), the chef; Tom (Haley Joel Osment), the DJ; the college grad Lucas (Levon Hawke); reality star Sarah (Adria Arjona) and her boyfriend Cody; along with party-goers Camilla (Liz Caribel) and Heather (Trew Mullen), not to mention Slater’s steadfast assistant Stacy (Geena Davis). Upon their arrival, Stacy collects everyone’s phones, signaling a disconnection from the digital realm.

Once settled in her quarters, Frida stumbles upon a mysterious perfume bottle which she decides to apply liberally. A cryptic maid (María Elena Olivares) whispers “red rabbit” in her ear, instigating a series of perplexing events. As the guests gather by the pool, Frida takes a leisurely tour of the expansive property with Slater, discussing everything from ominous lurking snakes to her new venture in animal-themed nail art.

As evening descends, the group assembles for dinner infused with the heady allure of MDMA droplets. Frida awakens the next morning next to Jess, and discovers to her shock that the red stain on her dress is inexplicably gone, inviting an air of enigma that thickens with each passing moment. A sense of dread starts to envelop Frida as she grapples with distorted memories and unsettling sensations: dirt trapped beneath her nails, unexplainable tastes lingering on her skin. Her conversations with Slater grow increasingly strange as he “reintroduces” her to Rich, a person she is certain she recognized from the gala just days prior. Meanwhile, Jess begins to notice the peculiarities that have been hiding in plain sight, particularly regarding the enigmatic maid and the island’s unsettling vibe.

As night falls, the festive atmosphere darkens when Jess screams in terror from a snake bite, prompting Slater to effortlessly handle the situation. While tending to Jess’s injury, she confides her growing apprehensions about an alarming presence lurking in the shadows of the island. Before retiring, Jess suffers a surprising nosebleed, seemingly purging her body of an unseen malady.

The next day, Frida sets out to confront Slater but encounters the maid again, who offers her a potent liquor made with venom, adding to the sense of foreboding. Despite its overwhelming effect, Frida continues to unravel the unsettling mystery plaguing the island, gathering cryptic clues: Sarah’s surprising bruise, Jess’s inexplicable disappearance, and the unnerving silence shrouding Camilla and Heather’s collective memory loss.

In a shocking turn, Frida discovers a hidden knife behind her mirror, coupled with a jarring flashback of Jess urging her to keep it concealed. Determined to uncover the sinister truth behind the island’s red gift bags and the flower-scented perfumes muddling their memories, Frida teams up with Sarah. Together, they concoct a plan to reverse the effects of their foggy recollections, tricking Camilla and Heather into consuming the snake venom laced with tequila in a desperate attempt to regain their lost clarity. Even Stacy ultimately succumbs to the intoxicating concoction.

As the night progresses, the atmosphere thickens with tension; Frida stealthily slips into Slater’s office on a mission to reclaim their phones and gather vital information. Meanwhile, Sarah remains vigilant, prepared to intervene as necessary. Frida’s clandestine exploration leads her to reveal chilling snapshots of past atrocities echoing their current nightmarish ordeal, revitalizing her memories of horror, anguish, and captivity.

As the intensity heightens, Frida recalls vivid moments of terror, detailing Slater’s culpability, Stan’s brutality, and the malign intentions behind the perfume. With newfound resolve, Frida reconvenes with Sarah to strategize their next steps. Their dinner transforms into an impromptu war council, wherein they initiate a spontaneous dance party—a calculated distraction to aid their escape.

As haunting memories surge within them, the atmosphere booms with chaos. Camilla’s recollections spark her rage, leading her to exact fatal retribution on Tom, while Heather’s distress prompts her to retaliate violently against Vic, only to be silenced by Stan’s brutal intervention. In the ensuing turmoil, Frida confronts an enraged Stacy in a climactic brawl that ends with Frida emerging victoriously.

Outside, Sarah confronts Cody in the wooded expanse, swiftly ending their encounter. Lucas, meanwhile, stands a reluctant witness to the unfolding nightmare, gradually remembering the unspeakable events he has tried to ignore. As Frida and Sarah advance toward Slater’s domain, they are greeted by a horrific scene: a fatally wounded Camilla lies at Slater’s feet. The distraction affords them a fleeting moment of hope—until Lucas is abruptly cut down by gunfire when he opens the door for them.

As the dust settles, Frida and Sarah prepare themselves for the inevitable confrontation with Slater, the mastermind pulling the strings behind their trauma. With determination in their hearts and vengeance in their eyes, they approach the final showdown that could redefine their fates.

Bursting into the lavish confines of the villa, Frida is overtaken by recollections of her painful past. The puzzle pieces fall into place, recalling her desperate attempts to flee the island a year prior, the jagged scars on her head serving as grim reminders of the brutality she endured. Confronting Slater, she senses his escalating agitation; he readies himself for a lethal act against Sarah, yet Frida is ahead of him—secretly having tampered with his vape pen to incapacitate him with the potent toxin.

As chaos ensues, Frida seizes the opportunity to drag Slater to safety, momentarily escaping the destructive fire that engulfs the villa, claiming Vic in its merciless grip. The closing shot captures Frida standing solitary amid the flames, with her bewildered captor witnessing the inferno of their lavish façade consume them whole.

In the aftermath, Frida makes a triumphant entrance at a grand gala, elegantly accompanied by a now-docile Slater, who remains under the influence of the flower toxin. Her gaze locks on Rich, tension palpable as he grapples with the haunting reality that her memories are returning, unlocking a profound familiarity that troubles him. The evening reaches a frenetic peak as she is introduced not only as Slater’s wife but also the new CEO of his corporation—a powerful role that she embraces with newfound confidence and authority.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Watch Trailers, Clips & Behind-the-Scenes for Blink Twice

See more

Watch official trailers, exclusive clips, cast interviews, and behind-the-scenes footage from Blink Twice. Dive deeper into the making of the film, its standout moments, and key production insights.


Official Trailer

Official Trailer 2

First Look Featurette

A Shocking Debut – Featurette

On Location - Featurette

Slater Introduces His Crew – Official Clip

A Little Different Now – Official Clip

Something Horrible is About to Happen – Official Clip

That’s How You Win – Official Clip

Wake Up – Official Clip

Movie Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


murder mysterypoolrape and revengesexual abuseislandswimming poolmexican womanmexicancaucasianblack womanafrican americanrape victimrapemexican islandfemale protagonistpenis drawn on facewatching a video on a cellphonechampagnecigarette lighterprivate islandslasher horrorlizard fingernail decalrepressed memoryreference to pop rockstwo word titlegaybillionairestabbingmemorygunshotcellphone taken awaydrugsnosebleedcell phonemysterious womancampfireblooddinnerfirebare chested maleperfumecandlesnakedressmoneytoiletknifechickenairplanewatermelon

Similar Movies You Should Know About

Browse a curated list of movies similar in genre, tone, characters, or story structure. Discover new titles like the one you're watching, perfect for fans of related plots, vibes, or cinematic styles.


© 2025 What's After the Movie. All rights reserved.