Intervista 1987

   Federico Fellini welcomes us into his world of film making with a mockumentary about his life in film, as a Japanese film crew follows him around.

Federico Fellini welcomes us into his world of film making with a mockumentary about his life in film, as a Japanese film crew follows him around.

Does Intervista have end credit scenes?

No!

Intervista does not have end credit scenes. You can leave when the credits roll.

Where to Watch Intervista

See current US streaming, rental, and purchase options for Intervista (1987) via JustWatch.


Streaming availability powered by JustWatch

Meet the Full Cast and Actors of Intervista

Explore the complete cast of Intervista, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Marcello Mastroianni

Marcello Mastroianni

Marcello Mastroianni

Christian Borromeo

Christian Borromeo

Christian

Anita Ekberg

Anita Ekberg

Anita Ekberg

Antonella Ponziani

Antonella Ponziani

La Ragazza del Tram

Antonio Cantafora

Antonio Cantafora

Lo Sposo

Lara Wendel

Lara Wendel

La Sposa

Maria Teresa Battaglia

Maria Teresa Battaglia

Recruited Actress at the Train Station

Maurizio Mein

Maurizio Mein

L'Aiuto Regista

Nadia Ottaviani

Nadia Ottaviani

La Vestale

Paola Liguori

Paola Liguori

La Diva

Sergio Rubini

Sergio Rubini

Il Giornalista

Paola Cozzo

Paola Cozzo

Girl at Casting (uncredited)

Lionello Pio Di Savoia

Lionello Pio Di Savoia

Aurelio

Paolo Fiorino

Paolo Fiorino

Police Detective (uncredited)

Domiziano Arcangeli

Domiziano Arcangeli

Candidate Actor for the Role of Karl (uncredited)

Sophie Hicks

Sophie Hicks

Androgenic Actress (uncredited)

Delia D'Alberti

Delia D'Alberti

Olga (uncredited)

Franca Maresa

Franca Maresa

Old Actress (uncredited)

Rosa Pianeta

Rosa Pianeta

(uncredited)

Fabio Galli

Fabio Galli

Arabian Courtier (uncredited)

Clarita Gatto

Clarita Gatto

"Fellinian" Woman (uncredited)

Francesca Reggiani

Francesca Reggiani

Francesca, Diva's Secretary

Roberto Nobile

Roberto Nobile

Romantic Film Assistant Director (uncredited)

Patrizia Sacchi

Patrizia Sacchi

"Amerika" Makeup Department Member

Natale Tulli

Natale Tulli

Worker (uncredited)

Tonino Delli Colli

Tonino Delli Colli

Tonino Delli Colli (uncredited)

Roberto Ceccacci

Roberto Ceccacci

Ceccacci, an Assistant (uncredited)

Fabio Bussotti

Fabio Bussotti

Historical Film Assistant Director (uncredited)

Pietro Notarianni

Pietro Notarianni

Pietro Notarianni / Fascist (uncredited)

Fiammetta Profili

Fiammetta Profili

Fellini's Assistant (uncredited)

Clotilde De Spirito

Clotilde De Spirito

Flora, a Fat Actress (uncredited)

Nathalie Guetta

Nathalie Guetta

"Amerika" Troupe Member (uncredited)

Marcello Colasurdo

Marcello Colasurdo

Maharaja (uncredited)

Eva Grimaldi

Eva Grimaldi

Actress at Audition

Pietro Bertone

Pietro Bertone

Faustino, Romantic Film Runner (uncredited)

Piero Vivaldi

Piero Vivaldi

Pietro, Fellini's Driver (uncredited)

Dario Casalini

Dario Casalini

(uncredited)

Ettore Geri

Ettore Geri

Menicuccio

Armando Marra

Armando Marra

Historical Film Director

Vito Passeri

Vito Passeri

Actor at Casting (uncredited)

Armando Tortorici

Armando Tortorici

Historical Film Set Assistant (uncredited)

Cesare Martignoni

Cesare Martignoni

Actor Talking About the Kamasutra #1 (uncredited)

Antonella Antinori

Antonella Antinori

Girl at Casting (uncredited)

Giuseppe Transocchi

Giuseppe Transocchi

Walking Monk (uncredited)

Salvatore Biondo

Salvatore Biondo

Actor Wearing Star of David (uncredited)

Rolando De Santis

Rolando De Santis

Il Chiodo

Eleonora Cecere

Eleonora Cecere

Little Girl on Train (uncredited)

Mario Cei

Mario Cei

Candidate Actor for the Role of Karl (uncredited)

Franco Adducci

Franco Adducci

Subway Passenger (uncredited)

Claudio Ciocca

Claudio Ciocca

Actor Talking About the Kamasutra #2 (uncredited)

Roberto Mannoni

Roberto Mannoni

Production Manager (uncredited)

Walter Mramor

Walter Mramor

Young Assistant Director (uncredited)

Vittorio Calò

Vittorio Calò

Train Passenger (uncredited)

Massimiliano Martoriati

Massimiliano Martoriati

Dancer (uncredited)

Umberto Conte

Umberto Conte

Photographer

Roberta Carlucci

Roberta Carlucci

Actress Recruited in the Subway

Germana Dominici

Germana Dominici

No Nudity Actress

Adriana Facchetti

Adriana Facchetti

Diva's Assistant

Alessandro Marino

Alessandro Marino

Romantic Film Director

Faustone Signoretti

Faustone Signoretti

Cinecittà Gate Guard

Mario Miyakawa

Mario Miyakawa

Japanese Troupe Memeber

Antonello Zanini

Antonello Zanini

Antonello

Otello Belardi

Otello Belardi

Production Assistant (uncredited)

Fabiana Calò

Fabiana Calò

Train Passenger (uncredited)

Marco Carniti

Marco Carniti

"Amerika" Actor (uncredited)

Stefano Corsi

Stefano Corsi

Assistant Director (uncredited)

Giuseppe Mauro Cruciano

Giuseppe Mauro Cruciano

"Amerika" Actor (uncredited)

Danilo Donati

Danilo Donati

Danilo Donati (uncredited)

Francesca Fenati

Francesca Fenati

Girl at Casting (uncredited)

Ingrid Lill Høgtun

Ingrid Lill Høgtun

Girl at Casting (uncredited)

Michele Janczarek Kapucinski

Michele Janczarek Kapucinski

Priest (uncredited)

Gino Millozza

Gino Millozza

Gino Millozza (uncredited)

Roberto Narducci

Roberto Narducci

Subway Passenger (uncredited)

Riccardo Onorato

Riccardo Onorato

Electrician (uncredited)

Claudio Parise

Claudio Parise

Set Worker (uncredited)

Take the Ultimate Intervista Movie Quiz

Challenge your knowledge of Intervista with this fun and interactive movie quiz. Test yourself on key plot points, iconic characters, hidden details, and memorable moments to see how well you really know the film.


Intervista Quiz: Test your knowledge of Federico Fellini's 1987 self‑reflexive film Intervista.

Who directed the film Intervista?

Full Plot Summary and Ending Explained for Intervista

See more

Read the complete plot summary of Intervista, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


Federico Fellini invites viewers behind the scenes at Cinecittà, where a nighttime set is readied for a sequence he dubs “the prisoner’s dream.” In this moment, his hands search for a way out of a dark tunnel, mirroring the aging director’s own sense of time catching up with him. As night gives way to morning, the tour resumes and the mood shifts from dreamlike hazard to documentary curiosity. The crew walks past glossy, ever-moving TV commercials in production, while the casting director introduces four young actors chosen to embody Karl Rossmann, the lead from the studio’s imagined adaptation of Kafka’s Amerika. On-screen, the famed Nadia Ottaviani appears as the custodian of Cinecittà, a brief and charming distraction as she slips away to pick dandelions for herbal tea, adding a touch of whimsy to the earnest hustle of film-making. The assistant director, Maurizio Mein, corrals the team on location at the Casa del Passeggero, a once-cheap hotel transformed into a drugstore set, a location Fellini longs to reclaim from a past visit to Cinecittà in 1938 during the Fascist era.

The narrative then folds time upon itself as Fellini interacts with his younger self, played by the rising actor Sergio Rubini. Their dialogue and staging dramatize the tension between memory and invention, as the team rebuilds the Casa del Passeggero façade elsewhere in Rome and a fake tramway whisks Fellini’s younger self from an imagined American West, through a moment with Indian warriors on a cliff, to a herd of elephants off a distant Ethiopian coast. This dreamlike travelogue leads to Cinecittà proper, where Fellini seeks out Katya, a stand-in for Greta Gonda, and conducts a casting encounter that blurs the lines between memory, performance, and reality.

What follows is a seamless drift into two separate feature films that function as tyrannical mirrors of the filmmaking process. For a stretch, Fellini and his on-set arranger scramble to assemble the correct cast and construct the necessary sets for Amerika, a fictive adaptation that serves as a pretext for filming what is already in progress. The narrative vaults between eras and personas, letting Marcello Mastroianni reprise a telegenic role in a TV commercial as Mandrake the Magician, while a sudden bomb threat punctures the illusion. A pivotal scene unfolds at Anita Ekberg’s house, where she and Mastroianni revisit moments from La Dolce Vita, underscoring how cinema constantly revisits its own history. Screenshots of Kafka’s Brunelda appear, caressed in a bathtub by two young men, before a violent thunderstorm signals the collapse of the Amerika production, culminating in a surreal assault by bogus Indians riding horseback and brandishing television antennas as if they were spears.

Back inside Studio 5, the film-within-a-film experiment circles toward a close. Fellini’s voiceover cuts in with a stark, almost clinical honesty: “So the movie should end here. Actually, it’s finished.” When producers push back against his somber endings, the Maestro counters with a fleeting glimmer of light—igniting an arc lamp to cast a final, hopeful glow over the whole production.

This intimate, self-reflexive portrait of making movies—part diary, part fantasia—explores how memory, artistry, and stubborn ambition collide on a soundstage that feels as much like a living museum as a workplace. It’s a meditation on aging, the persistence of dreams, and the stubborn magic of cinema that continues to shape how we see both the past and the present.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore the mobile app

Discover Film Music Concerts Near You – Live Orchestras Performing Iconic Movie Soundtracks

Immerse yourself in the magic of cinema with live orchestral performances of your favorite film scores. From sweeping Hollywood blockbusters and animated classics to epic fantasy soundtracks, our curated listings connect you to upcoming film music events worldwide.

Explore concert film screenings paired with full orchestra concerts, read detailed event information, and secure your tickets for unforgettable evenings celebrating legendary composers like John Williams, Hans Zimmer, and more.

Concert Film CTA - Music Note
Concert Film CTA - Green Blue Wave

Cars Featured in Intervista

See 24 more

Explore all cars featured in Intervista, including their makes, models, scenes they appear in, and their significance to the plot. A must-read for car enthusiasts and movie buffs alike.


Alfa

1939

Romeo 6C 2500 Turismo

Alfa

1982

Romeo Alfetta

Autobianchi

1976

A112

BMW

1975

320 E21

Citroën

1983

BX

Fiat

1949

1100 ELR

Fiat

1974

126

Fiat

170

Fiat

1978

238 E

Fiat

650 N

Intervista Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


reference to toshiro mifunereference to amerika by franz kafkareference to greta garbotelevisionkama sutraartistic creationcinecittamovie studiodirector cameotv interviewdream tellingassistant directoradvertisementchicoryfascist saluteroman salutemise en abymejapanese womanjapanese manjapanese translatorbomb alertgreat danereference to mandrake the magiciannostalgiareference to la dolce vitareference to elvis presleyactorinterviewcinemamagiciankafkacommercialmemoryindianspotsafarirome italynonlinear timelineflashbackitalian cinemashowerrainold agenightmaking oflipstickfogfilm studiofemale nuditydream

Intervista Other Names and Titles

Explore the various alternative titles, translations, and other names used for Intervista across different regions and languages. Understand how the film is marketed and recognized worldwide.


Fellini's Intervista Interview Görüşme Fellinis Intervista インテルビスタ Entrevista Інтерв'ю Интервью Interviu 인터뷰 访谈录 ფელინის ინტერვიუ 訪談錄

Similar Movies To Intervista You Should Know About

Browse a curated list of movies similar in genre, tone, characters, or story structure. Discover new titles like the one you're watching, perfect for fans of related plots, vibes, or cinematic styles.


© 2026 What's After the Movie. All rights reserved.

Privacy Policy