Logo What's After the Movie
A young gamer with exceptional racing skills is given the unprecedented opportunity to pursue his passion in real-world professional motorsports. Based on the incredible true story of Jann Mardenborough, the film follows his journey from virtual competitions to the high-stakes world of racing, facing intense challenges and pushing boundaries to achieve his dreams and become a champion.

A young gamer with exceptional racing skills is given the unprecedented opportunity to pursue his passion in real-world professional motorsports. Based on the incredible true story of Jann Mardenborough, the film follows his journey from virtual competitions to the high-stakes world of racing, facing intense challenges and pushing boundaries to achieve his dreams and become a champion.

Does Gran Turismo have end credit scenes?

No!

Gran Turismo does not have end credit scenes. You can leave when the credits roll.

Meet the Full Cast and Actors of Gran Turismo

Explore the complete cast of Gran Turismo, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Ratings and Reviews for Gran Turismo

See how Gran Turismo is rated across major platforms like IMDb, Metacritic, and TMDb. Compare audience scores and critic reviews to understand where Gran Turismo stands among top-rated movies in its genre.


Echo Score

The Movie Echo Score

57

Gran Turismo delivers an engaging showcase of high‑octane racing visuals that many viewers find exciting, yet its narrative foundation wavers under the weight of promotional overtones. Critics note a competent direction and solid production values, while repeatedly pointing to underdeveloped character arcs and a pacing that stretches beyond its narrative needs. Audience reactions echo this split, with enthusiastic fans praising the dream‑chasing core and detractors highlighting a thin emotional core. Overall the film lands in the middle of the quality spectrum, offering moments of thrill but limited lasting impact.

The Movie Echo Score Breakdown for Gran Turismo

55
Echo Score

Art & Craft

In terms of art and craft, the film presents polished cinematography and purposeful race‑sequence framing that many viewers find visually appealing. Critics acknowledge competent assembly but also cite a sleek, sometimes textureless aesthetic that detracts from depth. User comments highlight both admiration for detailed visual fidelity and complaints about inconsistent CGI quality. The mixed feedback results in a moderate appraisal of the film’s technical execution.

45
Echo Score

Character & Emotion

When evaluating character and emotion, the movie struggles to establish fully realized protagonists. Critics repeatedly mention a lack of compelling human focus and shallow development outside the track scenes. Some praise a central youthful figure, yet overall commentary points to a void where deeper emotional resonance could reside. Audience sentiment mirrors this, with several viewers describing the lead as bland and the romance as ineffective, leading to a below‑average character rating.

55
Echo Score

Story & Flow

The story and flow receive a mixed assessment. The premise of a gamer‑turned‑driver offers an original hook that critics and some users find inspiring, while pacing issues and a predictable structure are frequently noted. The narrative’s willingness to blend sub‑genres is praised by a few, yet the overall coherence is considered merely adequate. Consequently, the film attains a middling score for its storytelling qualities.

60
Echo Score

Sensory Experience

Sensory experience is highlighted by vibrant race footage and a soundtrack that many viewers find exhilarating. Critics commend the energetic visual style despite occasional remarks about excessive sleekness. User feedback frequently celebrates the excitement of the racing scenes, though one critic emphasizes poor CGI execution. The balance of strong auditory‑visual moments with isolated technical criticisms yields a slightly above‑average sensory rating.

70
Echo Score

Rewatch Factor

Rewatch factor appears relatively strong, driven by the film’s exhilarating race sequences and an inspirational underdog narrative that resonates with fans of the franchise. Several audience members express a desire to revisit the motivational aspects, while critics suggest the movie may perform better on home platforms than in theatres. Despite noted flaws, the overall enjoyment potential on subsequent viewings lifts this aspect above the median.

Metacritic

48

Metascore

7.2

User Score

Rotten Tomatoes
review

65%

TOMATOMETER

review

98%

User Score

IMDb

7.1 /10

IMDb Rating

TMDB

77

%

User Score

Letterboxd

3.4

From 2.7K fan ratings

Movie Insider

4.50/5

From 6 fan ratings

Take the Ultimate Gran Turismo Movie Quiz

Challenge your knowledge of Gran Turismo with this fun and interactive movie quiz. Test yourself on key plot points, iconic characters, hidden details, and memorable moments to see how well you really know the film.


Gran Turismo Quiz Challenge: Test your knowledge about the journey of Jann Mardenborough in Gran Turismo.

Who is the visionary behind the Gran Turismo driving simulator?

Full Plot Summary and Ending Explained for Gran Turismo

See more

Read the complete plot summary of Gran Turismo, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


Kazunori Yamauchi, played by Takehiro Hira, is the visionary behind Gran Turismo, hailed as the most precise racing simulator ever created. His aspiration is to make the world of racing accessible to everyone. After a bold proposal from marketing executive Danny Moore, the motor-sport division of Nissan, known as Nismo, launches the GT Academy. This innovative initiative aims to transform skilled Gran Turismo players into real-life racing champions. Danny is convinced that with 80 million youths engaging with Gran Turismo, the potential to identify a champion from this pool could revolutionize the way people view their physical race cars.

To spearhead the training, Danny recruits former driver-turned-mechanic Jack Salter, who initially expresses reluctance to take on this challenge. His hesitation stems from the perceived arrogance of his team’s driver, Nicholas Capa. Jack is deeply concerned about the risk involved in transforming a novice gamer into someone who could handle the dangers of racing at 200 mph, while Danny argues that these gamers possess more track time than many professional racers.

On the other side of the story is Jann Mardenborough, a passionate teenage gamer and part-time employee at a clothing store in Cardiff, Wales. Jann is eager to pursue his dream of becoming a professional racer, despite the disapproval from his father, Steve Mardenborough, a former footballer who believes racing has no future. Jann firmly believes that racing is where his true talents lie.

His journey takes an exciting turn when he learns he is qualified for a race that can secure his spot in the GT Academy. The night before competition day, he decides to attend a party with his brother Coby, where he also meets the charming Audrey, played by Maeve Courtier-Lilley, igniting a romantic interest. However, the night spirals out of control when police arrive, prompting Jann to speed away from a confrontation. His father later finds out, leading to a stern lesson in responsibility, but Jann ultimately prioritizes his passion for racing and successfully wins his place in the Academy.

Once at the GT Academy camp in Silverstone, UK, Jack rigorously tests the competitors, including Jann, Matty, Antonio, and others, to pare down their numbers. During one test, Jann surprises Jack by crashing and revealing the car’s glazed brakes, which he had initially thought to be unlikely. Ultimately, Jann impresses everyone by narrowly winning the final race against American contender Matty Davis, despite Danny’s initial inclination to select Matty for his marketability.

With a chance to earn a professional racing license within his grasp, Jann learns that he must finish at least fourth in any of the qualifying races. His path to success is rocky, starting with a last-place finish in Austria after a collision with Nicholas. With each race, Jann gradually improves, moving into the crucial qualifying race in Dubai, where he finally secures his fourth-place finish and an official license. Following this victory, he travels to Tokyo with Danny and Jack, where he shares a momentous signing and begins a relationship with Audrey.

Jann’s debut race at the Nürburgring Nordschleife starts on a high note, but it quickly turns tragic as he crashes into a spectator area, which leads to a fatality. The weight of this incident haunts him, causing him to withdraw from the sport as he grapples with guilt. To support him, Jack takes Jann back to the scene, where he shares his own harrowing history with racing—the loss of a fellow driver in a fatal accident.

Despite an official inquiry clearing Jann, public perception shifts against sim drivers, leading Danny to assemble a team of competing drivers, including Matty and Antonio, to represent Nissan at Le Mans. On race day, Jann’s father expresses his remorse for not supporting his son’s ambitions earlier. As the race unfolds, Jann’s resolve is tested after witnessing a catastrophic crash but finds motivation in the tunes that Jack plays through the car’s communication system.

Despite several obstacles, including mechanical mishaps during pit stops, Jann defies the odds and sets a new competition lap record. In the final stretch, he faces Nicholas, culminating in a nail-biting finish that secures him a third-place podium standing, establishing a historic win for Nissan.

In the moving epilogue, viewers learn about the real Jann Mardenborough, who has gone on to race over 200 times and has shown remarkable resilience, even serving as his own stunt double in this inspiring film.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Watch Trailers, Clips & Behind-the-Scenes for Gran Turismo

See more

Watch official trailers, exclusive clips, cast interviews, and behind-the-scenes footage from Gran Turismo. Dive deeper into the making of the film, its standout moments, and key production insights.


Official Trailer

Official Trailer 2

Official UK Trailer #2

The Real Deal

Dream Come True

Jann Mardenborough as a Stunt Driver

Driving Pods

Neill Blomkamp's Approach

Use of Drones

Gran Turismo Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


based on video gamecardriverprofessionalmotorsportteenage boyyoung boyla marseillaisechasesontrainingbased on true storygran turismovehicleraceracingroadcircuitdrivingrivalsim racingracing gamefather son relationshippolicedriving a carcar chasecar racingcar racelistening to musicairplanecar crashhospitaldeathguiltchampagnenissanyear 2011year 2012year 2013year 2014year 2015academycareercrashtracklifeesportsfathermotherlove

Gran Turismo Other Names and Titles

Explore the various alternative titles, translations, and other names used for Gran Turismo across different regions and languages. Understand how the film is marketed and recognized worldwide.


Gran Turismo: Based on a True Story Gran Turismo. No spēles līdz trasei Gran Turismo - De Jogador a Corredor GT. Gran Turismo GT Gran Turismo. De gamer a racer Gran Turismo: Tay Đua Cự Phách Gran Turismo: D'après une histoire vraie گرن توریسمو GT赛车:极速狂飙 Gran Turismo: De Jugador a Corredor Gran Turismo: De Jogador a Corredor Tay Đua Cự Phách جران توريزمو 그란 투리스모 Ґран Туризмо GT:跨界玩家 Gran Turismo: De jugador a corredor グランツーリスモ Gran Turismo - La storia di un sogno impossibile GT 跑車浪漫旅 GT แกร่งทะลุไมล์ גראן טוריסמו Гран Туризмо გრან ტურიზმო

Similar Movies To Gran Turismo You Should Know About

Browse a curated list of movies similar in genre, tone, characters, or story structure. Discover new titles like the one you're watching, perfect for fans of related plots, vibes, or cinematic styles.


© 2026 What's After the Movie. All rights reserved.