The Hourglass Sanatorium 1973

Josef travels to a decaying sanatorium to see his father, but discovers the building a maze of rooms that each open into shifting landscapes of his own memories, dreams and nightmares. As he moves from one chamber to another, the boundary between reality and his inner world blurs, forcing him to confront hidden emotions and his past.

Josef travels to a decaying sanatorium to see his father, but discovers the building a maze of rooms that each open into shifting landscapes of his own memories, dreams and nightmares. As he moves from one chamber to another, the boundary between reality and his inner world blurs, forcing him to confront hidden emotions and his past.

Does The Hourglass Sanatorium have end credit scenes?

No!

The Hourglass Sanatorium does not have end credit scenes. You can leave when the credits roll.

Where to Watch The Hourglass Sanatorium

See current US streaming, rental, and purchase options for The Hourglass Sanatorium (1973) via JustWatch.


Streaming availability powered by JustWatch

Meet the Full Cast and Actors of The Hourglass Sanatorium

Explore the complete cast of The Hourglass Sanatorium, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Jerzy Trela

Jerzy Trela

Wesolek (uncredited)

Jerzy Braszka

Jerzy Braszka

Wax Figure of Leatherstocking

Marek Barbasiewicz

Marek Barbasiewicz

Waiter

Jan Nowicki

Jan Nowicki

Józef

Bożena Adamek

Bożena Adamek

Bianka

Hans-Joachim Recknitz

Hans-Joachim Recknitz

Jew (uncredited)

Jerzy Janeczek

Jerzy Janeczek

Wax Figure of Luigi Lucheni

Andrzej Herder

Andrzej Herder

Wax Figure of Buffalo Bill

Gustaw Holoubek

Gustaw Holoubek

Dr. Gotard

Waldemar Gawlik

Waldemar Gawlik

Nameless Man (uncredited)

Elżbieta Kijowska

Elżbieta Kijowska

Jerzy Przybylski

Jerzy Przybylski

Mr. de Voss

Paweł Unrug

Paweł Unrug

Ornithologist

Stefania Staszewska

Stefania Staszewska

Jewish Woman (uncredited)

Tadeusz Kondrat

Tadeusz Kondrat

Jakub

Henryk Boukołowski

Henryk Boukołowski

Fireman

Włodzimierz Nowak

Włodzimierz Nowak

Wax Figure of Archduke Maximilian

Wojciech Standełło

Wojciech Standełło

Jew Interlocutor in Restaurant

Jan Szurmiej

Jan Szurmiej

Instructive Jewish Man

Szymon Szurmiej

Szymon Szurmiej

Jewish Man Reciting False Qoheleth's Verses

Gołda Tencer

Gołda Tencer

Jewish Woman (uncredited)

Zofia Bajuk

Zofia Bajuk

Wax Figure of Queen Elizabeth

Seweryn Dalecki

Seweryn Dalecki

Teodor

Mirosława Lombardo

Mirosława Lombardo

Wax Figure of Queen Draga

Herman Lercher

Herman Lercher

Jew (uncredited)

Michał Szwejlich

Michał Szwejlich

Jewish Man by the Ladder

Wiktor Sadecki

Wiktor Sadecki

Dignitary

Mieczysław Voit

Mieczysław Voit

Blind Conductor

Ludwik Benoit

Ludwik Benoit

Szloma

Romuald Drobaczyński

Romuald Drobaczyński

Irena Malkiewicz

Irena Malkiewicz

Lady in Black

Józef Łodyński

Józef Łodyński

Majordomo in Panopticon

Wladyslaw Sitko

Wladyslaw Sitko

Wax Figure of Alfred Dreyfus

Irena Izykowska

Irena Izykowska

Bearded Woman at Final Party (uncredited)

Leszek Kowalewski

Leszek Kowalewski

Wax Figure of a Young Genius

Bolesław Mierzejewski

Bolesław Mierzejewski

Wax Figure of Franz Joseph I

Czesław Piaskowski

Czesław Piaskowski

Wax Figure of Otto von Bismarck

Irena Orska

Irena Orska

Józef's Mother

Halina Kowalska

Halina Kowalska

Adela

Tadeusz Schmidt

Tadeusz Schmidt

Officer

Leopold Rene Nowak

Leopold Rene Nowak

Rudy / Ptak (uncredited)

Janina Sokołowska

Janina Sokołowska

Nurse

Marek Jasiński

Marek Jasiński

Ruth Taru-Kowalska

Ruth Taru-Kowalska

Jewish Woman (uncredited)

Edward Radulski

Edward Radulski

Emir Buczacki

Emir Buczacki

Wax Figure of Benito Juarez

Stanisław Tylczyński

Stanisław Tylczyński

Wax Figure of Thomas Edison (uncredited)

Julian Jabczyński

Julian Jabczyński

Dignitary

Jerzy Bekker

Jerzy Bekker

Wax Figure of Napoleon III

Jolanta Hanisz

Jolanta Hanisz

Bianka's Mother

J. Jablonski

J. Jablonski

Barbara Okonska-Kozlowska

Barbara Okonska-Kozlowska

Tluja

Stanisław Olczyk

Stanisław Olczyk

Wax Figure of Victor Emmanuel

P. Podgórski

P. Podgórski

Wax Figure of Maximilien de Robespierre

Barbara Rogalska

Barbara Rogalska

Waldemar Rutecki

Waldemar Rutecki

Jolanta Jackowska

Jolanta Jackowska

Wax Figure of Charlotte Corday (uncredited)

Alicja Kluba

Alicja Kluba

Wax Figure of George Sand (uncredited)

Paweł Szurmiej

Paweł Szurmiej

(uncredited)

Full Plot Summary and Ending Explained for The Hourglass Sanatorium

See more

Read the complete plot summary of The Hourglass Sanatorium, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


Joseph, Jan Nowicki travels through a dream-like, liminal landscape aboard a dilapidated train to visit his dying father, Jacob, in a sanatorium that feels more like a memory than a hospital. Upon arrival, he discovers a place on the brink of ruin: corridors that seem to breathe, patients left unsupervised, and a sense that the clock has forgotten how to tell time. The sanatorium’s walls murmur with echoes of the past as time itself behaves in capricious, unpredictable ways, reanimating moments that may have happened long ago or were never meant to occur at all.

Joseph is an adult in appearance, yet his choices and impulses often carry the innocence, curiosity, and vulnerability of a child. He forms a delicate bond with Rudolf, a curious young boy who keeps a postage stamp album, and Filip Zylber brings that character to life with a quiet wonder. The stamps—tiny windows into distant places—trigger a cascade of associations and adventures, weaving a tapestry of memory, longing, and possibility as Joseph moves through the hospital’s shifting rooms and remembered scenes.

In the midst of this dreamlike odyssey, Joseph re-enters childhood episodes with his wildly eccentric father, a figure who even now lives among birds in an attic, heightening the sense that the boundary between father and son, past and present, is porous and playful. The film weds intimate memory to grand, surreal imagery, inviting the viewer to trace how memory can shape identity as surely as it shapes space and time.

The narrative also drifts into moments of formal disruption: at one point, Joseph is arrested by a mysterious unit of soldiers for having a dream that is harshly criticized by those in power, a sequence that underscores the film’s sly critique of authority and censorship. Another thread follows the boyhood fantasy of a girl Joseph once imagined, a reminiscence that surfaces with tenderness and unease, testing how longing can coexist with unease in a nightmarish beauty.

As the dream deepens, Joseph commandeers a group of historic wax mannequins, turning them into an hallucinatory chorus that amplifies the film’s sense of spectacle and possibility. An ominous, blind train conductor returns repeatedly, a death-like presence who stalks the carriages and headlines Joseph’s journey with a chilling, inexorable rhythm. The conductor is brought to life on screen by Mieczysław Voit, whose performance anchors the piece’s haunting mood.

Interwoven with these surreal episodes are reflections on the Holocaust that extend beyond the source texts, reading Bruno Schulz’s prose through the prism of the author’s death in World War II and the broader destruction of the world he described. These meditations deepen the film’s meditation on memory, art, and the fragility of human history, lending a moral weight to the dreamlike imagery without dulling its wonder.

All of these elements—the dream logic, the artful disarray of the sanatorium, the odd companionships, the wax-figure tableaux, and the haunting refrain of the blind conductor—cohere into a visually arresting phantasmagoria. The result is a long, singular voyage through grief, memory, and imagination that feels both intimate and epic, inviting viewers to linger on textures, faces, and the elastic surface of time itself. The film remains resolutely faithful to its mood while expanding the sense of possibility that memory can hold, even as it warns of the ways in which history can distort, renew, and haunt us.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore the mobile app

Watch Trailers, Clips & Behind-the-Scenes for The Hourglass Sanatorium

See more

Watch official trailers, exclusive clips, cast interviews, and behind-the-scenes footage from The Hourglass Sanatorium. Dive deeper into the making of the film, its standout moments, and key production insights.


Sanatorium pod Klepsydra (1973) Trailer

The Hourglass Sanatorium Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


alternate realitysurrealismfather son relationshipbedbooksoldiertime travelpsychiatristmetaphysicsfemale nudityalternate dimensionsanitoriumcandy cinemafemale rear nudityfemale full frontal nudityfatherfolk horrorpsychological dramasupernatural fantasytrainprostituteeatingjewbirdfogcandlemother son relationshipchildwoodsplantnursehelmetparrotmemoryexistentialismmeaning of lifemannequingraveyarddecaydeathchildhood memory

The Hourglass Sanatorium Other Names and Titles

Explore the various alternative titles, translations, and other names used for The Hourglass Sanatorium across different regions and languages. Understand how the film is marketed and recognized worldwide.


O Sanatório da Clepsidra 砂制时镜下的疗养院 El sanatorio de la clepsidra O Sanatório de Clepsidra The Hour-Glass Sanatorium The Sandglass La Clepsydre 모래시계 요양원 Санаторий «Под клепсидрой» Das Sanatorium zur Todesanzeige El Sanatorio de la Clepsidra La clessidra Sanatorium timglaset Санаторій під клепсидрою Klepsidros sanatorija

Similar Movies To The Hourglass Sanatorium You Should Know About

Browse a curated list of movies similar in genre, tone, characters, or story structure. Discover new titles like the one you're watching, perfect for fans of related plots, vibes, or cinematic styles.


© 2026 What's After the Movie. All rights reserved.

Privacy Policy