Ride Him, Bosko 1932

A western‑themed cartoon starring Bosko, packed with slap‑stick shooting gags that shrink characters, a lively sequence where the cast turn into singing playing cards, and an over‑the‑top alcohol gag in which a potent drink instantly transforms a male piano player into a woman.

A western‑themed cartoon starring Bosko, packed with slap‑stick shooting gags that shrink characters, a lively sequence where the cast turn into singing playing cards, and an over‑the‑top alcohol gag in which a potent drink instantly transforms a male piano player into a woman.

Does Ride Him, Bosko have end credit scenes?

No!

Ride Him, Bosko does not have end credit scenes. You can leave when the credits roll.

Meet the Full Cast and Actors of Ride Him, Bosko

Explore the complete cast of Ride Him, Bosko, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Take the Ultimate Ride Him, Bosko Movie Quiz

Challenge your knowledge of Ride Him, Bosko with this fun and interactive movie quiz. Test yourself on key plot points, iconic characters, hidden details, and memorable moments to see how well you really know the film.


Ride Him, Bosko (1932) Quiz: Test your knowledge of the classic animated short featuring Bosko, his adventures, and the quirky characters that appear throughout the film.

What instrument does Bosko play while sitting at the piano in the saloon?

Full Plot Summary and Ending Explained for Ride Him, Bosko

See more

Read the complete plot summary of Ride Him, Bosko, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


Under a full moon, a coyote watches over a lonely mountaintop and lets out a long, eerie howl. The creature takes a deep breath, his form puffing up as if inflated by invisible air, and then releases another resonant howl that cuts through the night.

Bosko rides a cheerful horse, strumming a banjo and singing the old cowboy tune “When the Bloom is on the Sage.” The horse balks at a stubborn rock in the path, forcing Bosko to slide off and help push the animal over the barrier before they can press on.

The mood shifts to a black screen where words appear as the music changes to a piano rendition of “She’ll Be Coming ’Round the Mountain.” The transition signals a new vignette: a road outside a saloon, where shadows in the windows hint at revelry inside. A quick, chaotic gun chase erupts nearby, and a passer-by is knocked aside by a flying bottle of beer. A comically tall cowboy struts down the road, only to have the middle of his body shot away, shrinking him down to the size of a dwarf.

Bosko arrives on the scene just as his horse collapses beside the curb. He strides toward the saloon on the opposite side of the road, opens the doors with a jaunty “Howdy,” and is met with a volley of gunfire. The patrons greet him with a chorus of “Hi Bosko,” and Bosko laughs with a touch of nervous bravado. He retrieves his bullet-riddled hat and steps inside, where a three-piece band—banjo, violin, and piano—keep a lively tempo as they play the same tune. The moment is playful and chaotic: the piano player hammers the keys so hard that a mug of beer streaks through the air, pours into the player’s mouth, and, in a comic twist, causes his clothes to burst into flames. His clothes vanish, leaving him in bloomers, lips puckered with lipstick, and a coy, crossed-knee pose as he saunters away.

At the piano, Bosko continues to drive the rhythm as he taps his feet and rocks the bench in time with the music. A set of four playing cards—King, Jack, Queen, and Joker—appears in someone’s hand. They sing briefly, then the Joker is shot, deflating the performance into a moment of audience laughter. Bosko remains at the piano, the scene swirling with dancers around him as the music swells.

Honey, Bosko’s sweetheart, enters a separate high-speed sequence: a carriage rushing along a bumpy highway with a large trunk strapped to its roof. The ride tosses Honey about, and she urges the driver to be careful. A gang of highwaymen lurks nearby, moving stealthily along a cliff as they scout for a target. They strike as the carriage speeds past, guns blazing, but the trunk finally slips loose and its contents spill out—the clothes themselves taking on a life of their own, hotly escaping the hail of bullets in a comic scramble. A corset literally flies off into the air.

Inside the carriage, the driver is hurled from his perch and crashes onto a tall cactus, sliding down as hundreds of thorns cling to him. The rattled rider tumbles onto the skeleton of a bull, which unexpectedly revives and bolts away with the rider clinging on for dear life.

Back at the saloon, the driver staggers in, deflates dramatically, and collapses into his own pants, dipping a mug into the beer and pouring it over himself for a final comic beat.

[Bosko] mounts his horse again and gallops to the rescue, his steed vaulting effortlessly over the rocks that once slowed them. The bandits press the pursuit, and Honey leans from a window, pleading for Bosko to save her. The chase intensifies as Bosko churns forward, closing the distance with a burst of speed.

The frame then widens to show the cartoon’s makers—Hugh Harman, Norman Blackburn, and Rudy Ising—watching the action and providing sound effects. Ising leans in with a quizzical question about how to spur Bosko to act, Harman admits he’s not sure what to do, and Ising suggests they need to do something. Blackburn sighs and decides they should go home, and with that, the trio exits, leaving Bosko to his fate in the lurching, sunlit chase.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Explore the mobile app

Discover Film Music Concerts Near You – Live Orchestras Performing Iconic Movie Soundtracks

Immerse yourself in the magic of cinema with live orchestral performances of your favorite film scores. From sweeping Hollywood blockbusters and animated classics to epic fantasy soundtracks, our curated listings connect you to upcoming film music events worldwide.

Explore concert film screenings paired with full orchestra concerts, read detailed event information, and secure your tickets for unforgettable evenings celebrating legendary composers like John Williams, Hans Zimmer, and more.

Concert Film CTA - Music Note
Concert Film CTA - Green Blue Wave

Ride Him, Bosko Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


bosko characterfilm within a filmsurrealismhyperbolic physical distortionyelling for helpvillainstagecoachstagecoach robberystagecoach driversongsingingsinging cowboysight gagshot to deathshot with a gunsaloonpiano playingpianistperson on firelowinglong underwearlive action sequencehomosexual subtexthit with a bottlegunflattened like a pancakeeffeminacydancingdancedamsel in distressdachshundcow skeletoncorsetcharacter deflatescartoon reality crossovercartoon pigcartoon horsecartoon dachshundcactusbulletbullet holebullet hits hatbreaking the fourth wallbeerdrinking beeranthropomorphismanthropomorphic playing cardanthropomorphic clothesanimate skeletonanimate object
Movie Wiki CTA - Movie Book

Unlock the World of Movies with Our Comprehensive Wiki

Dive into our Movie Wiki for in-depth film encyclopedia entries, including cast biographies, production trivia, plot synopses, behind-the-scenes facts, and thematic analyses. Whether you’re researching iconic directors, exploring genre histories, or discovering hidden easter eggs, our expertly curated movie database has everything you need to fuel your cinematic passion.

Movie Wiki CTA - Green Blue Wave

Similar Movies To Ride Him, Bosko You Should Know About

Browse a curated list of movies similar in genre, tone, characters, or story structure. Discover new titles like the one you're watching, perfect for fans of related plots, vibes, or cinematic styles.


© 2026 What's After the Movie. All rights reserved.

Privacy Policy