Logo What's After the Movie
A shy 13-year-old boy, Alex, moves from Kansas City to Mexico to spend time with his relatives. While adjusting to a new culture and forming new friendships, he discovers a young chupacabra cub, Chupa, hiding near his grandfather’s shed. When a dangerous scientist threatens Chupa, Alex must protect his newfound friend and unravel the mysteries surrounding his family’s history, embarking on an exciting adventure filled with unexpected challenges.

A shy 13-year-old boy, Alex, moves from Kansas City to Mexico to spend time with his relatives. While adjusting to a new culture and forming new friendships, he discovers a young chupacabra cub, Chupa, hiding near his grandfather’s shed. When a dangerous scientist threatens Chupa, Alex must protect his newfound friend and unravel the mysteries surrounding his family’s history, embarking on an exciting adventure filled with unexpected challenges.

Does Chupa have end credit scenes?

No!

Chupa does not have end credit scenes. You can leave when the credits roll.

Meet the Full Cast and Actors of Chupa

Explore the complete cast of Chupa, including both lead and supporting actors. Learn who plays each character, discover their past roles and achievements, and find out what makes this ensemble cast stand out in the world of film and television.


Ratings and Reviews for Chupa

See how Chupa is rated across major platforms like IMDb, Metacritic, and TMDb. Compare audience scores and critic reviews to understand where Chupa stands among top-rated movies in its genre.


Echo Score

The Movie Echo Score

69

Chupa presents a modestly enjoyable family adventure that leans on cultural charm and likable characters while struggling with uneven storytelling and visual execution. Critics note a rich sense of place and occasional strong performances, yet many point to generic plot beats and subpar CGI. User feedback echoes this split, praising the film's heart and soundtrack but lamenting uneven acting and animation quality. Overall, the movie offers pleasant moments for younger audiences but leaves a mixed impression for broader viewers.

The Movie Echo Score Breakdown for Chupa

75
Echo Score

Art & Craft

In terms of art and craft, Chupa demonstrates solid direction and an appealing visual palette that captures Mexican locales. Critics commend the sense of place and some reviewers highlight nicely filmed sequences, while others cite inconsistent visual effects and occasional editing lapses. Users echo the appreciation for the musical score and scenery but criticize the animation quality. The cumulative view is that the film’s technical execution is competent with notable flaws.

68
Echo Score

Character & Emotion

When evaluating character and emotion, the film succeeds in presenting likable, relatable youths and a charming creature. Critics and users alike praise the chemistry of the young cast and a standout performance by Demian Bichir. Conversely, several reviews mention stiff child acting and underdeveloped villain depth. The overall character work is engaging for its target audience, though hampered by occasional performance shortcomings.

65
Echo Score

Story & Flow

Regarding story and flow, Chupa delivers a familiar coming‑of‑age narrative that feels both heartfelt and derivative. Positive commentary highlights its wholesome themes and cultural references, while criticism points to generic plot structure and missed opportunities to explore the chupacabra myth. Users note both the adorable premise and moments of repetitive pacing. The narrative therefore lands as serviceable but lacking in originality.

70
Echo Score

Sensory Experience

In the sensory experience domain, the movie offers an enjoyable soundtrack and vibrant Mexican scenery that reinforce its tone. Reviewers commend the musical score’s magical quality and the visual appeal of location shots. However, feedback also notes inconsistent CGI and animation quality that detract from immersion. The sensory components largely support the film’s mood despite technical imperfections.

68
Echo Score

Rewatch Factor

For rewatch factor, Chupa possesses a modest replay value anchored by its heartwarming moments and cultural flavor. Critics suggest it will engage children on repeat viewings, and many users describe it as a comforting family film worth revisiting. Yet, some reviewers find it forgettable beyond an initial watch due to narrative blandness. Consequently, the film offers moderate lasting appeal for its intended audience.

Metacritic

48

Metascore

5.1

User Score

Rotten Tomatoes
review

71%

TOMATOMETER

review

58%

User Score

IMDb

5.5 /10

IMDb Rating

TMDB

63

%

User Score

Letterboxd

2.4

From 2 fan ratings

Movie Insider

4.67/5

From 6 fan ratings

Take the Ultimate Chupa Movie Quiz

Challenge your knowledge of Chupa with this fun and interactive movie quiz. Test yourself on key plot points, iconic characters, hidden details, and memorable moments to see how well you really know the film.


Chupa Quiz: Test your knowledge about the movie Chupa!

What mythical creature does Alex befriend?

Full Plot Summary and Ending Explained for Chupa

See more

Read the complete plot summary of Chupa, including all major events, twists, and the full ending explained in detail. Explore key characters, themes, hidden meanings, and everything you need to understand the story from beginning to end.


Scientist Richard Quinn is on a quest to capture the chupacabra, a legendary creature, in San Javier to exploit its supposed abilities. While tracking it down in an abandoned mine, he encounters the creature, who, upon being injured by a vehicle, abandons her baby to distract the pursuing scientists. After the passing of his father, Beto, due to cancer, 13-year-old Alex flies to Mexico to connect with his extended family for the first time—a trip that was originally planned for him and his father. In Mexico, he meets his grandfather Chava, a former lucha libre champion, along with his lively cousin Memo, who is obsessed with wrestling, and his brave cousin Luna.

On his first night there, Alex stumbles upon a young chupacabra cub, which starts licking a cut on his hand when he wakes up. Aware of the negative reputation surrounding it’s species, Alex decides to keep this a secret. Shortly after, Luna takes him and Memo into town to find Chava, informing them that he often gets lost possibly due to Alzheimer’s disease. In the market, Alex sees a colorful figurine labeled “chupacabra,” which the vendor surprisingly claims isn’t that dangerous.

While retracing their steps home, the kids find Chava walking with a goat that he inexplicably purchased. However, they soon encounter men searching an area for clues, as Quinn begins to collect evidence of the creature’s existence. At the ranch, the family watches a news report on the dreaded full-grown chupacabra, rumored to prey on livestock. Chava dismisses the report, deeming it misinformation. Shortly after, Alex confides in Luna that he believes their grandfather is hiding something, revealing a music box he found in the barn. She attributes it to his mental state.

Later, while playing with the music box, Alex hears strange noises and discovers a peculiar creature that resembles a mix between a mammal and a bird, complete with small dog-sized wings. He attempts to feed it sausages from the house and promises to protect it during an incoming thunderstorm. The next morning, Memo searches for Alex and finds him with the friendly young chupacabra, initially causing a panic. However, once Luna arrives, they soon convince her of the creature’s gentle nature. Alex argues that they must protect it as if it were a baby, and Chava supports his decision.

Chava reveals a surprising connection, divulging that he accidentally hit its parent with his car and found the baby nearby, opting to keep it hidden from those who would exploit it. However, trouble arrives when Quinn introduces himself, claiming to represent an American government agency on the hunt for rare species for medical research, tracing a license plate from the crash back to Chava. As Chava stands his ground, threatening to demonstrate a lucha libre move to keep Quinn away, Alex promises Chupa that he will find its family.

Memo decides to help Chupa learn to fly, taking it up to the barn roof. After a few attempts that involve some comical crashes into hay, Alex and Chava bond over memories of Alex’s father’s past wrestling career. As Chava reveals that Beto never reached the professional stage due to marrying Alex’s mother and moving to America, Alex retreats into his feelings by playing his Game Boy. Chava insists on a playful wrestling match, pushing Alex to confront his emotions. With the knowledge of Chupa’s secret ties to their family, and with Quinn hot on their trail, the family embarks on an unforgettable adventure to protect the innocent creature from imminent danger.

Uncover the Details: Timeline, Characters, Themes, and Beyond!

Mobile App Preview

Coming soon on iOS and Android

The Plot Explained Mobile App

From blockbusters to hidden gems — dive into movie stories anytime, anywhere. Save your favorites, discover plots faster, and never miss a twist again.

Sign up to be the first to know when we launch. Your email stays private — always.

Watch Trailers, Clips & Behind-the-Scenes for Chupa

See more

Watch official trailers, exclusive clips, cast interviews, and behind-the-scenes footage from Chupa. Dive deeper into the making of the film, its standout moments, and key production insights.


Official Trailer

Christian Slater & Demián Bichir Play With Baby Goats While Answering Questions

Chupa Themes and Keywords

Discover the central themes, ideas, and keywords that define the movie’s story, tone, and message. Analyze the film’s deeper meanings, genre influences, and recurring concepts.


youngteenageryoung boyteenage boymexicomythicalcreatureexplorationtrippowergrandfatherchildchildrenfarmerlifelifetimejourneyfriendmonstermagicchupacabrafolkloretreasurecarflashlightcavefriendshipdefendmysticalprotectfake cactusmagical placelatin americafeathershootingsecrethuntingfamily relationshipscar chasefairy talelucha libremexican wrestlingu.s. governmentmedicinegame boykansas citygriefmysterious deathgreedcancer

Chupa Other Names and Titles

Explore the various alternative titles, translations, and other names used for Chupa across different regions and languages. Understand how the film is marketed and recognized worldwide.


Meu Amigo Lutcha アレックスとチュパ Чупа 我的吸血怪好友 내 친구 추파카브라 Chupa: A Criatura Mítica ชูปาเพื่อนฉัน צ’ופה تشوبا Čupa

© 2026 What's After the Movie. All rights reserved.